PDB entry 1lwt

View 1lwt on RCSB PDB site
Description: Crystal structure of the intein homing endonuclease PI-SceI bound to its substrate DNA (Ca2+ free)
Deposited on 2002-06-03, released 2002-09-27
The last revision prior to the SCOP 1.71 freeze date was dated 2002-09-27, with a file datestamp of 2002-09-27.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.242
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lwtA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lwtA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    ssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivel
    vkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapi
    lyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervtey
    aeklnlcaeykdrkaktvnlyskvvrgngirnnlntenplwdaivglgflkdgvknipsf
    lstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglvvsvnae
    pakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfyfelqel
    keddyygitlsddsdhqfllanqvvvhn