PDB entry 1lws

View 1lws on RCSB PDB site
Description: Crystal structure of the intein homing endonuclease PI-SceI bound to its recognition sequence
Class: hydrolase/DNA
Keywords: homing endonuclease, intein, protein-DNA complex, endonuclease
Deposited on 2002-06-03, released 2002-09-27
The last revision prior to the SCOP 1.73 freeze date was dated 2002-09-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.287
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease pi-scei
    Species: Saccharomyces cerevisiae
    Gene: VMA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17255 (0-453)
      • modified residue (9)
      • modified residue (27)
      • modified residue (46)
      • modified residue (108)
      • modified residue (192)
      • modified residue (235)
      • modified residue (371)
      • modified residue (384)
    Domains in SCOP 1.73: d1lwsa1, d1lwsa2, d1lwsa3
  • Chain 'B':
    Compound: PI-SceI DNA recognition region top strand
  • Chain 'C':
    Compound: PI-SceI DNA recognition region bottom strand
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lwsA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lwsA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgvfevitfemgqkkapdgrivel
    vkevsksypisperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapily
    endhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyae
    klnlcavaktvnlysenplwdaivglgflkdgvknipsflstdnigtretflaglidsdg
    yvtdehgikatiktihtsvrdglvslarslglvvsvnaepakvdmngtkhkisyaiymsg
    gdvllnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqflla
    nqvvvhn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.