PDB entry 1lws

View 1lws on RCSB PDB site
Description: Crystal structure of the intein homing endonuclease PI-SceI bound to its recognition sequence
Deposited on 2002-06-03, released 2002-09-27
The last revision prior to the SCOP 1.69 freeze date was dated 2002-09-27, with a file datestamp of 2002-09-27.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.287
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lwsA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lwsA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgvfevitfemgqkkapdgrivel
    vkevsksypisperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapily
    endhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyae
    klnlcavaktvnlysenplwdaivglgflkdgvknipsflstdnigtretflaglidsdg
    yvtdehgikatiktihtsvrdglvslarslglvvsvnaepakvdmngtkhkisyaiymsg
    gdvllnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqflla
    nqvvvhn