PDB entry 1lwm

View 1lwm on RCSB PDB site
Description: solution structure of the sequence-non-specific hmgb protein nhp6a
Deposited on 2002-05-31, released 2002-10-16
The last revision prior to the SCOP 1.67 freeze date was dated 2002-10-16, with a file datestamp of 2002-10-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1lwma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lwmA (A:)
  mvtprepkkrttrkkkdpnapkralsaymffanenrdivrsenpditfgqvgkklgekwk
  altpeekqpyeakaqadkkryesekelynatla