PDB entry 1lwm

View 1lwm on RCSB PDB site
Description: Solution Structure of the Sequence-Non-Specific HMGB protein NHP6A
Class: DNA binding protein
Keywords: hmg-box, hmgb, alpha helix, DNA binding protein
Deposited on 2002-05-31, released 2002-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nonhistone chromosomal protein 6A
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NHP6A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lwma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwmA (A:)
    mvtprepkkrttrkkkdpnapkralsaymffanenrdivrsenpditfgqvgkklgekwk
    altpeekqpyeakaqadkkryesekelynatla