PDB entry 1lwh

View 1lwh on RCSB PDB site
Description: crystal structure of t. maritima 4-alpha-glucanotransferase
Class: transferase
Keywords: 4-alpha-glucanotransferase, alpha-amylase family, Thermotoga maritima, acarbose
Deposited on 2002-05-31, released 2002-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: mgt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lwha1, d1lwha2
  • Chain 'B':
    Compound: 4-alpha-glucanotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: mgt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lwhb1, d1lwhb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwhA (A:)
    migyqiyvrsfrdgnldgvgdfrglknavsylkelgidfvwlmpvfssisfhgydvvdfy
    sfkaeygserefkemieafhdsgikvvldlpihhtgflhtwfqkalkgdphyrdyyvwan
    ketdlderrewdgekiwhpledgrfyrglfgpfspdlnydnpqvfdemkrlvlhlldmgv
    dgfrfdaakhmrdtieqnvrfwkyflsdlkgiflaeiwaearmvdehgrifgymlnfdts
    hcikeavwkentrvliesieraviakdylpvnftsnhdmsrlasfeggfskekiklsisi
    lftlpgvplvfygdelgmkgvyqkpntevvldpfpwnesmcvegqtfwkwpayngpfsgi
    sveyqkrdpdsilshtlgwtrfrkenqwidrakleflckedkflvyrlyddqhslkvfhn
    lsgeevvfegvkmkpyktevv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwhB (B:)
    migyqiyvrsfrdgnldgvgdfrglknavsylkelgidfvwlmpvfssisfhgydvvdfy
    sfkaeygserefkemieafhdsgikvvldlpihhtgflhtwfqkalkgdphyrdyyvwan
    ketdlderrewdgekiwhpledgrfyrglfgpfspdlnydnpqvfdemkrlvlhlldmgv
    dgfrfdaakhmrdtieqnvrfwkyflsdlkgiflaeiwaearmvdehgrifgymlnfdts
    hcikeavwkentrvliesieraviakdylpvnftsnhdmsrlasfeggfskekiklsisi
    lftlpgvplvfygdelgmkgvyqkpntevvldpfpwnesmcvegqtfwkwpayngpfsgi
    sveyqkrdpdsilshtlgwtrfrkenqwidrakleflckedkflvyrlyddqhslkvfhn
    lsgeevvfegvkmkpyktevv