PDB entry 1lwf

View 1lwf on RCSB PDB site
Description:
Deposited on 2002-05-31, released 2002-10-30
The last revision prior to the SCOP 1.71 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1lwfa1, d1lwfa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1lwfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lwfA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictelekegkiskigpenpyntpv
    faikkknstrwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqyvddlyvgsdleigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lwfA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictelekegkiskigpenpyntpv
    faikklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkyt
    aftipnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqyvddlyvgs
    dleigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwtvqpivlpekds
    wtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenreilk
    epvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqltea
    vqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqlek
    epivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqdsgl
    evnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvdkl
    vsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lwfB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictelekegkiskigpenpyntpv
    faikkknstrwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqyvddlyvgsdleigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lwfB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictelekegkiskigpenpyntpvfaikk
    knstrwrklvdfrelnkrtqdfhpaglkkkksvtvldvgdayfsvpldedfrkytaftip
    sinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqyvddlyvgsdl
    eigqhrtkieelrqhllrwelhpdkwtvqpivlpekdswtvndiqklvgklnwasqiypg
    ikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdliaeiqkqg
    qgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktpkfklpi
    qketwetwwteywqatwipewefvntpplvklwyq