PDB entry 1lwe

View 1lwe on RCSB PDB site
Description: crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Deposited on 2002-05-31, released 2002-10-30
The last revision prior to the SCOP 1.71 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lweA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictelekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lweA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictelekegkiskigpenpyntpv
    faikkstkklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgs
    dleigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwtvqpivlpekds
    wtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenreilk
    epvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqltea
    vqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqlek
    epivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqdsgl
    evnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvdkl
    vsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lweB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictelekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lweB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictelekegkiskigpenpyntpvfaikk
    kdstkwrklvdfrelnkrtqdfiphpaglkkkksvtvldvgdayfsvpldedfrkytaft
    ipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgs
    dleigqhrtkieelrqhllrwglyyelhpdkwtvqpivlpekdswtvndiqklvgklnwa
    sqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdlia
    eiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktp
    kfklpiqketwetwwteywqatwipewefvntpplvklwyq