PDB entry 1lwd

View 1lwd on RCSB PDB site
Description: crystal structure of nadp-dependent isocitrate dehydrogenase from porcine heart mitochondria
Deposited on 2002-05-31, released 2002-11-13
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-13, with a file datestamp of 2002-11-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lwda_
  • Chain 'B':
    Domains in SCOP 1.63: d1lwdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwdA (A:)
    adqrikvakpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvtid
    salatqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiicknipr
    lvpgwtkpitigrhahgdqykatdfvvdragtfkivftpkdgssakqwevynfpaggvgm
    gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifekhyktdfd
    kykiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
    ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtle
    kvcvetvesgamtkdlagcihglsnvklnehflntsdfldtiksnldralgrq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwdB (B:)
    adqrikvakpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvtid
    salatqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiicknipr
    lvpgwtkpitigrhahgdqykatdfvvdragtfkivftpkdgssakqwevynfpaggvgm
    gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifekhyktdfd
    kykiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
    ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtle
    kvcvetvesgamtkdlagcihglsnvklnehflntsdfldtiksnldralgrq