PDB entry 1lwd

View 1lwd on RCSB PDB site
Description: crystal structure of nadp-dependent isocitrate dehydrogenase from porcine heart mitochondria
Class: oxidoreductase
Keywords: tricarboxylic acid cycle, oxidoreductase, nadp
Deposited on 2002-05-31, released 2002-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lwda_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lwdb_
  • Heterogens: MN, SO4, ICT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwdA (A:)
    adqrikvakpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvtid
    salatqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiicknipr
    lvpgwtkpitigrhahgdqykatdfvvdragtfkivftpkdgssakqwevynfpaggvgm
    gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifekhyktdfd
    kykiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
    ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtle
    kvcvetvesgamtkdlagcihglsnvklnehflntsdfldtiksnldralgrq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwdB (B:)
    adqrikvakpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvtid
    salatqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiicknipr
    lvpgwtkpitigrhahgdqykatdfvvdragtfkivftpkdgssakqwevynfpaggvgm
    gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifekhyktdfd
    kykiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
    ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtle
    kvcvetvesgamtkdlagcihglsnvklnehflntsdfldtiksnldralgrq