PDB entry 1lwc

View 1lwc on RCSB PDB site
Description: crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Deposited on 2002-05-31, released 2002-10-30
The last revision prior to the SCOP 1.69 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lwcA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqyvddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lwcA (A:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfak
    lvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkytaftip
    sinnpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqyvddlyvgsdlei
    gqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpekdswtvn
    diqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenreilkepvh
    gvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqki
    ttesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqlekepiv
    gaetfyvdagyvtnrgrqkvvttnqktelqaiylalqdsglevnivtdsqyalgiiqaqp
    dqseselvnqiieqlikkekvylawvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lwcB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqyvddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lwcB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk
    kdstkwrklvdfrelnkrtqdfwiphpaglkkkksvtvldvgdayfsvpldedfrkytaf
    tipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqyvddlyvg
    sdleigqhrtkieelrqhllrwgppflwmgyelhpdkwtvqpivlpekdswtvndiqklv
    gklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydp
    skdliaeiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviwgkt
    pkfklpiqketwetwwteywqatwipewefvntpplvklwyq