PDB entry 1lwb

View 1lwb on RCSB PDB site
Description: Crystal structure of prokaryotic phospholipase A2 at atomic resolution
Class: hydrolase
Keywords: Phospholipase A2, atomic resolution, internal motion, HYDROLASE
Deposited on 2002-05-31, released 2003-06-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.103
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative secreted protein
  Species: Streptomyces violaceoruber [TaxId:1935]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Z4W2 (0-121)
  Domains in SCOPe 2.03: d1lwba_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lwbA (A:)
  apadkpqvlasftqtsassqnawlaanrnqsawaayefdwstdlctqapdnpfgfpfnta
  carhdfgyrnykaagsfdanksridsafyedmkrvctgytgekntacnstawtyyqavki
  fg