PDB entry 1lw7

View 1lw7 on RCSB PDB site
Description: nadr protein from haemophilus influenzae
Deposited on 2002-05-30, released 2002-08-07
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-07, with a file datestamp of 2002-08-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.236
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lw7A (A:)
    ekkvgvifgkfypvhtghinmiyeafskvdelhvivcsdtvrdlklfydskmkrmptvqd
    rlrwmqqifkyqknqifihhlvedgipsypngwqswseavktlfhekhfepsivfssepq
    dkapyekylglevslvdpdrtffnvsatkirttpfqywkfipkearpffaktvailgges
    sgksvlvnklaavfnttsaweygrefvfeklggdeqamqysdypqmalghqryidyavrh
    shkiafidtdfittqafciqyegkahpfldsmikeypfdvtillknntewvddglrslgs
    qkqrqqfqqllkklldkykvpyieiespsyldrynqvkaviekvlneeeiselqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw7A (A:)
    ekkvgvifgkfypvhtghinmiyeafskvdelhvivcsdtvrdlklfydskmkrmptvqd
    rlrwmqqifkyqknqifihhlvedgipsypngwqswseavktlfhekhfepsivfssepq
    dkapyekylglevslvdpdrtffnvsatkirttpfqywkfipkearpffaktvailgges
    sgksvlvnklaavfnttsaweygrefvfeklggdeqamqysdypqmalghqryidyavrh
    shkiafidtdfittqafciqyegkahpfldsmikeypfdvtillknnteqkqrqqfqqll
    kklldkykvpyieiespsyldrynqvkaviekvlneeeiselqn