PDB entry 1lw4

View 1lw4 on RCSB PDB site
Description: X-ray structure of L-Threonine Aldolase (low-specificity) in complex with L-allo-threonine
Class: lyase
Keywords: pyridoxal-5-phosphate, PLP, enzyme, product complex, threonine, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2002-05-30, released 2002-12-11
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • modified residue (4)
      • modified residue (19)
      • modified residue (23)
      • modified residue (63)
      • modified residue (70)
      • modified residue (95)
      • modified residue (102)
      • modified residue (113)
      • modified residue (197)
      • modified residue (202)
      • modified residue (228)
      • modified residue (233)
      • modified residue (250)
      • modified residue (284)
    Domains in SCOP 1.75: d1lw4a_
  • Chain 'B':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • modified residue (4)
      • modified residue (19)
      • modified residue (23)
      • modified residue (63)
      • modified residue (70)
      • modified residue (95)
      • modified residue (102)
      • modified residue (113)
      • modified residue (197)
      • modified residue (202)
      • modified residue (228)
      • modified residue (233)
      • modified residue (250)
      • modified residue (284)
    Domains in SCOP 1.75: d1lw4b_
  • Chain 'C':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • modified residue (4)
      • modified residue (19)
      • modified residue (23)
      • modified residue (63)
      • modified residue (70)
      • modified residue (95)
      • modified residue (102)
      • modified residue (113)
      • modified residue (197)
      • modified residue (202)
      • modified residue (228)
      • modified residue (233)
      • modified residue (250)
      • modified residue (284)
    Domains in SCOP 1.75: d1lw4c_
  • Chain 'D':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • cloning artifact (3)
      • modified residue (4)
      • modified residue (19)
      • modified residue (23)
      • modified residue (63)
      • modified residue (70)
      • modified residue (95)
      • modified residue (102)
      • modified residue (113)
      • modified residue (197)
      • modified residue (202)
      • modified residue (228)
      • modified residue (233)
      • modified residue (250)
      • modified residue (284)
      • modified residue (3)
    Domains in SCOP 1.75: d1lw4d_
  • Heterogens: CA, CL, TLP, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lw4A (A:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw4A (A:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lw4B (B:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw4B (B:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lw4C (C:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw4C (C:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lw4D (D:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw4D (D:)
    mmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgt
    mgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkai
    rprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasias
    gvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaa
    giialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiea
    lrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs