PDB entry 1lw4

View 1lw4 on RCSB PDB site
Description: x-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine
Deposited on 2002-05-30, released 2002-12-11
The last revision prior to the SCOP 1.71 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1lw4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1lw4b_
  • Chain 'C':
    Domains in SCOP 1.71: d1lw4c_
  • Chain 'D':
    Domains in SCOP 1.71: d1lw4d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lw4A (A:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw4A (A:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lw4B (B:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw4B (B:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lw4C (C:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw4C (C:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lw4D (D:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw4D (D:)
    mmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgt
    mgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkai
    rprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasias
    gvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaa
    giialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiea
    lrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs