PDB entry 1lw3

View 1lw3 on RCSB PDB site
Description: Crystal Structure of Myotubularin-related protein 2 complexed with phosphate
Class: hydrolase
Keywords: protein-phosphate complex, hydrolase
Deposited on 2002-05-30, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myotubularin-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MTMR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13614
      • engineered (419)
    Domains in SCOPe 2.07: d1lw3a1, d1lw3a2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lw3A (A:)
    masmetsssceslgsqpaaarppsvdslssastshsensvhtksasvvssdsistsadnf
    spdlrvlresnklaemeeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksm
    erdppfvldaslgvinrvekiggassrgensygletvckdirnlrfahkpegrtrrsife
    nlmkyafpvsnnlplfafeykevfpengwklydplleyrrqgipneswritkineryelc
    dtypallvvpanipdeelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrsk
    edekylqaimdsnaqshkififdarpsvnavankakgggyesedayqnaelvfldihnih
    vmreslrklkeivypnieethwlsnlesthwlehiklilagalriadkvesgktsvvvhs
    sdgwdrtaqltslamlmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrs
    pvflqfidcvwqmtrqfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrt
    vslwsyinsqledftnplygsysnhvlypvasmrhlelwvgyyirwnprmkpqepihnry
    kellakraelqkkveelqreisnrstssserasspaqcvtpvqtvvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw3A (A:)
    eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
    rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
    afeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipde
    elkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqs
    hkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypn
    ieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslaml
    mldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrq
    fptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftn
    plygsysnhvlypvasmrhlelwvgyyirwnpr