PDB entry 1lw0

View 1lw0 on RCSB PDB site
Description:
Deposited on 2002-05-30, released 2002-10-30
The last revision prior to the SCOP 1.65 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1lw0a1, d1lw0a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1lw0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lw0A (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw0A (A:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfak
    lvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkytaftip
    sinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgsdl
    eigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwtvqpivlpekdswt
    vndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenreilkep
    vhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavq
    kittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqlekep
    ivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsqyalg
    iiqaqpdqseselvnqiieqlikkekvylawvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lw0B (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglytpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw0B (B:)
    tvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikkk
    dstkwrklvdfrelnkrtqdfphpaglkkkksvtvldvgdayfsvpldedfrkytaftip
    sinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgsdl
    eigqhrtkieelrqhllrwgppflwmgyelhpdkwtvqpivlpekdswtvndiqklvgkl
    nwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskd
    liaeiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviwgktpkf
    klpiqketwetwwteywqatwipewefvntpplvklwyq