PDB entry 1lvu

View 1lvu on RCSB PDB site
Description: crystal structure of calf spleen purine nucleoside phosphorylase in a new space group with full trimer in the asymmetric unit
Deposited on 2002-05-29, released 2003-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-02, with a file datestamp of 2003-09-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1lvua_
  • Chain 'B':
    Domains in SCOP 1.67: d1lvub_
  • Chain 'C':
    Domains in SCOP 1.67: d1lvuc_
  • Chain 'D':
    Domains in SCOP 1.67: d1lvud_
  • Chain 'E':
    Domains in SCOP 1.67: d1lvue_
  • Chain 'F':
    Domains in SCOP 1.67: d1lvuf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lvuA (A:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvuA (A:)
    qngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestv
    pghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggln
    pnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqm
    geqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsli
    tnkvimdyeeagkqaaqkleqfvsllmasipv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lvuB (B:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvuB (B:)
    qngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestv
    pghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggln
    pnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqm
    geqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsli
    tnkvimdyeheevleagkqaaqkleqfvsllmasipv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lvuC (C:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvuC (C:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkqaaqkleqfvsllmasipv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lvuD (D:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvuD (D:)
    qngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestv
    pghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggln
    pnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqm
    geqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsli
    tnkvimdyesqheevleagkqaaqkleqfvsllmasipv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lvuE (E:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvuE (E:)
    qngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestv
    pghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggln
    pnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqm
    geqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsli
    tnkvimdykqaaqkleqfvsllmasipv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lvuF (F:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvuF (F:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyeqaaqkleqfvsllmasipv