PDB entry 1lvn

View 1lvn on RCSB PDB site
Description: crystal structure of e. coli amine oxidase complexed with tranylcypromine
Class: oxidoreductase
Keywords: Inhibitor complex, OXIDOREDUCTASE
Deposited on 2002-05-28, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper amine oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46883
      • modified residue (465)
    Domains in SCOPe 2.07: d1lvna1, d1lvna2, d1lvna3, d1lvna4
  • Chain 'B':
    Compound: copper amine oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46883
      • modified residue (465)
    Domains in SCOPe 2.07: d1lvnb1, d1lvnb2, d1lvnb3, d1lvnb4
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lvnA (A:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvnA (A:)
    mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
    kawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrftei
    sllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahgm
    vllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkvi
    syldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkpm
    qiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggmi
    vpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipra
    iavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidaga
    tgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslvam
    dpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqii
    pyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglgq
    yskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lvnB (B:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvnB (B:)
    hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
    nkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrfte
    isllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahg
    mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
    isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkp
    mqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggm
    ivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipr
    aiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidag
    atgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslva
    mdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqi
    ipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglg
    qyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk