PDB entry 1lvm

View 1lvm on RCSB PDB site
Description: catalytically active tobacco etch virus protease complexed with product
Deposited on 2002-05-28, released 2002-11-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1lvm.1
  • Chain 'B':
    Domains in SCOP 1.71: d1lvmb_
  • Chain 'E':
    Domains in SCOP 1.71: d1lvm.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvmA (A:)
    ghhhhhhhgeslfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnn
    gtllvqslhgvfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlv
    ttnfqtksmssmvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnf
    tntnnyftsvpknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lvmB (B:)
    ghhhhhhhgeslfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnn
    gtllvqslhgvfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlv
    ttnfqtksmssmvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnf
    tntnnyftsvpknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvmB (B:)
    slfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhg
    vfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksms
    smvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnftntnnyftsv
    pknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvmE (E:)
    eatqlmn