PDB entry 1lvl

View 1lvl on RCSB PDB site
Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution
Deposited on 1992-12-16, released 1994-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.45 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvl_ (-)
    qqtiqttlliigggpggyvaairagqlgiptvlvegqalggtclnigcipskalihvaeq
    fhqasrftepsplgisvasprldigqsvawkdgivdrlttgvaallkkhgvkvvhgwakv
    ldgkqvevdgqriqcehlllatgsssvelpmlplggpvisstealapkalpqhlvvvggg
    yiglelgiayrklgaqvsvvearerilptydseltapvaeslkklgialhlghsvegyen
    gcllandgkggqlrleadrvlvavgrrprtkgfnlecldlkmngaaiaidercqtsmhnv
    waigdvagepmlahramaqgemvaeiiagkarrfepaaiaavcftdpevvvvgktpeqas
    qqgldcivaqfpfaangramslesksgfvrvvarrdnhlilgwqavgvavselstafaqs
    lemgacledvagtihahptlgeavqeaalralghalhi