PDB entry 1lvl

View 1lvl on RCSB PDB site
Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1992-12-16, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lvla1, d1lvla2, d1lvla3
  • Heterogens: FAD, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvlA (A:)
    qqtiqttlliigggpggyvaairagqlgiptvlvegqalggtclnigcipskalihvaeq
    fhqasrftepsplgisvasprldigqsvawkdgivdrlttgvaallkkhgvkvvhgwakv
    ldgkqvevdgqriqcehlllatgsssvelpmlplggpvisstealapkalpqhlvvvggg
    yiglelgiayrklgaqvsvvearerilptydseltapvaeslkklgialhlghsvegyen
    gcllandgkggqlrleadrvlvavgrrprtkgfnlecldlkmngaaiaidercqtsmhnv
    waigdvagepmlahramaqgemvaeiiagkarrfepaaiaavcftdpevvvvgktpeqas
    qqgldcivaqfpfaangramslesksgfvrvvarrdnhlilgwqavgvavselstafaqs
    lemgacledvagtihahptlgeavqeaalralghalhi