PDB entry 1lvk

View 1lvk on RCSB PDB site
Description: x-ray crystal structure of the mg (dot) 2'(3')-o-(n-methylanthraniloyl) nucleotide bound to dictyostelium discoideum myosin motor domain
Class: contractile protein
Keywords: myosin, dictyostelium, motor, mant, ATPase, actin-binding, coiled coil, contractile protein
Deposited on 1997-09-05, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (Start-758)
      • conflict (64)
      • conflict (272-273)
      • conflict (311)
      • conflict (320-321)
      • conflict (442)
      • conflict (488)
      • conflict (492)
      • conflict (627)
      • conflict (706)
      • conflict (736)
    Domains in SCOPe 2.07: d1lvka1, d1lvka2
  • Heterogens: MG, MNT, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lvkA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktsdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqstsernyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqekylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfltvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryydlapnvprdaedsq
    katdavlkhlnidpeqfrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvkA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktsdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnqagvleqqilqanpileafgnakttrnnnssrfgkfie
    iqfnnagfisgasiqsylleksrvvfqstsernyhifyqllagataeekkalhlagpesf
    nylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgag
    egavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvka
    lygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqqffnh
    hmfkveqekylkekinldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshf
    skknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtkl
    fndpniasrafltvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldql
    rcngvlegiritrkgfpnriiyadfvkryydlapnvprdaedsqkatdavlkhlnidpeq
    frfgitkiffragqlarieeare