PDB entry 1lvb

View 1lvb on RCSB PDB site
Description: catalytically inactive tobacco etch virus protease complexed with substrate
Deposited on 2002-05-28, released 2002-11-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lvba_
  • Chain 'B':
    Domains in SCOP 1.63: d1lvbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvbA (A:)
    prdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgvfkvk
    ntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmssmvsd
    tsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvpknfm
    elltnqeaqqwvsgwrlnadsvlwgghkvfmskp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvbB (B:)
    prdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgvfkvk
    ntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmssmvsd
    tsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvpknfm
    elltnqeaqqwvsgwrlnadsvlwgghkvfmskp