PDB entry 1lv0

View 1lv0 on RCSB PDB site
Description: Crystal structure of the Rab effector guanine nucleotide dissociation inhibitor (GDI) in complex with a geranylgeranyl (GG) peptide
Class: signaling protein
Keywords: Protein-ligand complex, SIGNALING PROTEIN
Deposited on 2002-05-23, released 2003-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAB GDP disossociation inhibitor alpha
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21856 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d1lv0a1, d1lv0a2, d1lv0a3
  • Heterogens: SO4, GER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lv0A (A:)
    hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql
    legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk
    vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg
    qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf
    arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvrkagqvi
    riicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyiaiasttve
    ttdpekevepalellepidqkfvaisdlyepiddgsesqvfcscsydatthfettcndik
    diykrmagsafdfenmkrkqndvfgeadq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lv0A (A:)
    hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql
    legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk
    vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg
    qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf
    arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvrkagqvi
    riicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyiaiasttve
    ttdpekevepalellepidqkfvaisdlyepiddgsesqvfcscsydatthfettcndik
    diykrmagsafdf