PDB entry 1luz

View 1luz on RCSB PDB site
Description: Crystal Structure of the K3L Protein From Vaccinia Virus (Wisconsin Strain)
Class: Viral protein
Keywords: 5 stranded anti-parallel beta barrel, Viral protein
Deposited on 2002-05-23, released 2002-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.232
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein K3
    Species: Vaccinia virus [TaxId:10254]
    Gene: K3L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18378 (Start-87)
      • modified residue (45)
      • modified residue (47)
      • modified residue (83)
    Domains in SCOPe 2.07: d1luza_
  • Chain 'B':
    Compound: Protein K3
    Species: Vaccinia virus [TaxId:10254]
    Gene: K3L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18378 (Start-87)
      • modified residue (45)
      • modified residue (47)
      • modified residue (83)
    Domains in SCOPe 2.07: d1luzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1luzA (A:)
    mlafcyslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvg
    ktvkvkvirvdytkgyidvnykrmcrhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1luzA (A:)
    fcyslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvgktv
    kvkvirvdytkgyidvnykrmcrhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1luzB (B:)
    mlafcyslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvg
    ktvkvkvirvdytkgyidvnykrmcrhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1luzB (B:)
    yslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvgktvkv
    kvirvdytkgyidvnykrmcrhq