PDB entry 1luw

View 1luw on RCSB PDB site
Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
Class: oxidoreductase
Keywords: Human Manganese superoxide dismutase, MnSOD, OXIDOREDUCTASE
Deposited on 2002-05-23, released 2002-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
    Domains in SCOPe 2.07: d1luwa1, d1luwa2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
    Domains in SCOPe 2.07: d1luwb1, d1luwb2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1luwA (A:)
    khslpdlpydygalephinaqimqlhhskqhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1luwB (B:)
    khslpdlpydygalephinaqimqlhhskqhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk