PDB entry 1lus

View 1lus on RCSB PDB site
Description: catalytic and structural effects of amino-acid substitution at his 30 in human mnsod: insertion of val cgamma into the substrate access channel
Class: oxidoreductase
Keywords: human mitochondrial manganese superoxide dismutase, MnSOD
Deposited on 2002-05-23, released 2002-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-11-06, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.242
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
    Domains in SCOPe 2.07: d1lusa3, d1lusa4
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
    Domains in SCOPe 2.07: d1lusb3, d1lusb4
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lusA (A:)
    khslpdlpydygalephinaqimqlhhskvhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lusB (B:)
    khslpdlpydygalephinaqimqlhhskvhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk