PDB entry 1lum

View 1lum on RCSB PDB site
Description: NMR Structure of the Itk SH2 domain, Pro287trans, 20 low energy structures
Class: transferase
Keywords: cis/trans isomerization, interleukin-2 tyrosine kinase, Itk, t-cell specific kinase, tsk, src homology 2, SH2, proline, TRANSFERASE
Deposited on 2002-05-22, released 2002-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03526 (0-106)
      • cloning artifact (107)
    Domains in SCOPe 2.06: d1luma1, d1luma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lumA (A:)
    nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
    yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg