PDB entry 1lul

View 1lul on RCSB PDB site
Description: db58, a legume lectin from dolichos biflorus
Deposited on 1998-06-30, released 1998-12-30
The last revision prior to the SCOP 1.57 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.226
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1lula_
  • Chain 'B':
    Domains in SCOP 1.57: d1lulb_
  • Chain 'C':
    Domains in SCOP 1.57: d1lulc_
  • Chain 'D':
    Domains in SCOP 1.57: d1luld_
  • Chain 'E':
    Domains in SCOP 1.57: d1lule_
  • Chain 'F':
    Domains in SCOP 1.57: d1lulf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lulA (A:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lulA (A:)
    adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
    avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
    dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
    tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lulB (B:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lulB (B:)
    adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
    avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
    dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
    tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpddsttepldiasy
    lvrnvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lulC (C:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lulC (C:)
    adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
    avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
    dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
    tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpddsttepldiasy
    lvrnvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lulD (D:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lulD (D:)
    adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
    avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
    dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
    tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lulE (E:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lulE (E:)
    adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
    avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
    dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
    tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpddsttepldiasy
    lvrnvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lulF (F:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lulF (F:)
    adiqsfsfknfssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydkstg
    avaswatsftanifapnksssadgiafalvpvgsepksnflgvfdsdvydnsaqtvavef
    dtfsntwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslvhpsrr
    tsyivservditnelpeyvsigfsattglsytethdvlswsfasklpd