PDB entry 1luk

View 1luk on RCSB PDB site
Description: nmr structure of the itk sh2 domain, pro287cis, energy minimized average structure
Deposited on 2002-05-22, released 2002-11-27
The last revision prior to the SCOP 1.65 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1luka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lukA (A:)
    nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
    yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg