PDB entry 1luk

View 1luk on RCSB PDB site
Description: NMR Structure of the Itk SH2 domain, Pro287cis, Energy minimized average structure
Class: transferase
Keywords: cis/trans isomerization, interleukin-2 tyrosine kinase, Itk, t-cell specific kinase, tsk, src homology 2, SH2, proline, TRANSFERASE
Deposited on 2002-05-22, released 2002-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase ITK/TSK
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03526 (0-106)
    • cloning artifact (107)
  Domains in SCOPe 2.08: d1luka1, d1luka2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lukA (A:)
  nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
  yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg