PDB entry 1luj

View 1luj on RCSB PDB site
Description: Crystal Structure of the Beta-catenin/ICAT Complex
Class: structural protein
Keywords: Beta-catenin, ICAT, Wnt pathway, inhibitor
Deposited on 2002-05-22, released 2002-10-16
The last revision prior to the SCOP 1.73 freeze date was dated 2002-10-30, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1luja_
  • Chain 'B':
    Compound: beta-catenin-interacting protein ICAT
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NSA3
      • conflict (7)
      • conflict (48)
      • conflict (62)
    Domains in SCOP 1.73: d1lujb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lujA (A:)
    traipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndve
    tarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqega
    kmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimr
    tytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnls
    daatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvr
    tvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplika
    tvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrmeei
    vegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaae
    aieaegatapltellhsrnegvatyaaavlfrms
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lujA (A:)
    traipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndve
    tarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqega
    kmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimr
    tytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnls
    daatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvr
    tvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplika
    tvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrgvrmeeivegctgalhilar
    dvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegataplte
    llhsrnegvatyaaavlfrms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lujB (B:)
    mnregapakspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvssqlsqlpqhsi
    dqaaedvvmafsrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lujB (B:)
    gapakspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvssqlsqlpqhsidqaa
    edvvmafsrse