PDB entry 1luf

View 1luf on RCSB PDB site
Description: Crystal Structure of the MuSK Tyrosine Kinase: Insights into Receptor Autoregulation
Class: transferase
Keywords: phosphorylation, signal transduction, mass spectrometry
Deposited on 2002-05-22, released 2002-09-11
The last revision prior to the SCOP 1.73 freeze date was dated 2002-09-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.231
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muscle-specific tyrosine kinase receptor musk
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lufa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lufA (A:)
    gamesaavtlttlpsellldrlhpnpmyqrmplllnpkllsleyprnnieyvrdigegaf
    grvfqarapgllpyepftmvavkmlkeeasadmqadfqreaalmaefdnpnivkllgvca
    vgkpmcllfeymaygdlneflrsmsphtvcslshsdlstrarvsspgppplscaeqlcia
    rqvaagmaylserkfvhrdlatrnclvgenmvvkiadfglsrniysadyykadgndaipi
    rwmppesifynryttesdvwaygvvlweifsyglqpyygmaheeviyyvrdgnilacpen
    cplelynlmrlcwsklpadrpsfcsihrilqrmceraegtvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lufA (A:)
    lnpkllsleyprnnieyvrdigegafgrvfqarapgllpyepftmvavkmlkeeasadmq
    adfqreaalmaefdnpnivkllgvcavgkpmcllfeymaygdlneflrsmsppplscaeq
    lciarqvaagmaylserkfvhrdlatrnclvgenmvvkiadfglsrniysadyykdaipi
    rwmppesifynryttesdvwaygvvlweifsyglqpyygmaheeviyyvrdgnilacpen
    cplelynlmrlcwsklpadrpsfcsihrilqrmce