PDB entry 1lu2

View 1lu2 on RCSB PDB site
Description: dolichos biflorus seed lectin in complex with the blood group a trisaccharide
Class: lectin
Keywords: legume lectins, dolichos biflorus seed lectin, sugar binding
Deposited on 1998-07-30, released 1998-12-09
The last revision prior to the SCOP 1.73 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-252)
      • conflict (126)
    Domains in SCOP 1.73: d1lu2a_
  • Chain 'B':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-252)
      • conflict (126)
    Domains in SCOP 1.73: d1lu2b_
  • Heterogens: A2G, CA, MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lu2A (A:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lu2B (B:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl