PDB entry 1lu2

View 1lu2 on RCSB PDB site
Description: dolichos biflorus seed lectin in complex with the blood group a trisaccharide
Deposited on 1998-07-30, released 1998-12-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1lu2a_
  • Chain 'B':
    Domains in SCOP 1.55: d1lu2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lu2A (A:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lu2B (B:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl