PDB entry 1lu1

View 1lu1 on RCSB PDB site
Description: the structure of the dolichos biflorus seed lectin in complex with the forssman disaccharide
Deposited on 1998-07-24, released 1998-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1lu1__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lu1_ (-)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl