PDB entry 1ltx

View 1ltx on RCSB PDB site
Description: structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
Deposited on 2002-05-21, released 2003-05-21
The last revision prior to the SCOP 1.71 freeze date was dated 2003-05-21, with a file datestamp of 2003-05-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ltxA (A:)
    mhgrlkvktseeqaeakrlereqklklyqsatqavfqkrqageldesvleltsqilganp
    dfatlwncrrevlqhletekspeesaalvkaelgflesclrvnpksygtwhhrcwllsrl
    pepnwarelelcarfleadernfhcwdyrrfvaaqaavapaeelaftdslitrnfsnyss
    whyrscllpqlhpqpdsgpqgrlpenvllkelelvqnafftdpndqsawfyhrwllgrae
    phdvlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvw
    lcdlpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeqlfrcelsvek
    stvlqselesckelqelepenkwclltiillmraldpllyeketlqyfstlkavdpmraa
    ylddlrskfllensvlkmeyadvrvlhlahkdltvlchleqlllvthldlshnrlralpp
    alaalrclevlqasdnalenvdgvanlprlqelllcnnrlqqsaaiqplvscprlvllnl
    qgnslcqeegiqerlaemlpsvssilt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltxA (A:)
    klklyqsatqavfqkrqageldesvleltsqilganpdfatlwncrrevlqhletekspe
    esaalvkaelgflesclrvnpksygtwhhrcwllsrlpepnwarelelcarfleadernf
    hcwdyrrfvaaqaavapaeelaftdslitrnfsnysswhyrscllpqlhpqgrlpenvll
    kelelvqnafftdpndqsawfyhrwllgraepvlccvhvsreeaclsvcfsrpltvgsrm
    gtlllmvdeaplsvewrtpdgrnrpshvwlcdlpaaslndqlpqhtfrviwtgsdsqkec
    vllkdrpecwcrdsatdeqlfrcelsvekstvlqselesckelqelepenkwclltiill
    mraldpllyeketlqyfstlkavdpmraaylddlrskfllensvlkmeyadvrvlhlahk
    dltvlchleqlllvthldlshnrlralppalaalrclevlqasdnalenvdgvanlprlq
    elllcnnrlqqsaaiqplvscprlvllnlqgnslcqeegiqerlaemlpsvssilt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ltxB (B:)
    mgtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlm
    gqlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvv
    ayvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdgg
    fgcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvc
    yswwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsl
    lgeeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltxB (B:)
    kdvtiksdpdtlllekhadyiasygscmseylrmsgvywgltvmdlmgqlhrmnkeeilv
    fikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslqkedgsf
    agdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgseshagq
    iycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvlaslkiig
    rlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqikpvspvf
    cmpeevlqrvnvqpelvs
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1ltxR (R:)
    madnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlk
    eyqenndvvtensmwqeqileneeaiplsskdktiqhvevfcyasqdlhkdveeagalqk
    nhasvtsaqsaeaaeaaetsclptaveplsmgsceipaeqsqcpgpesspevndaeatgk
    kensdakssteepsenvpkvqdntetpkknritysqiikegrrfnidlvskllysrglli
    dlliksnvsryaefknitrilafregtveqvpcsradvfnskqltmvekrmlmkfltfcv
    eyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtsettsctvdglkatkkflq
    clgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdkesrkckavidqf
    gqriiskhfiiedsylsentcsrvqyrqisravlitdgsvlktdadqqvsiltvpaeepg
    sfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpyteieaeneqvek
    prllwalyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqqicpned
    fcpappnpedivldgdssqqevpessvtpetnsetpkestvlgnpeepse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltxR (R:)
    adnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlke
    yqentensmwqeqileneeaiplsskdktiqhvevfcyasqdknritysqiikegrrfni
    dlvskllysrgllidlliksnvsryaefknitrilafregtveqvpcsradvfnskqltm
    vekrmlmkfltfcveyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtstsct
    vdglkatkkflqclgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdk
    esrkckavidqfgqriiskhfiiedsylsentcsrvqyrqisravlitdgsvlktdadqq
    vsiltvpaeepgsfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpy
    teieekprllwalyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqq
    icpnedfpedivld