PDB entry 1lts

View 1lts on RCSB PDB site
Description: refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin
Deposited on 1992-07-15, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.95 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1lts.1
  • Chain 'C':
    Domains in SCOP 1.55: d1lts.1
  • Chain 'D':
    Domains in SCOP 1.55: d1ltsd_
  • Chain 'E':
    Domains in SCOP 1.55: d1ltse_
  • Chain 'F':
    Domains in SCOP 1.55: d1ltsf_
  • Chain 'G':
    Domains in SCOP 1.55: d1ltsg_
  • Chain 'H':
    Domains in SCOP 1.55: d1ltsh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ltsA (A:)
    rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
    lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
    iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
    pqgcg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ltsC (C:)
    gdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ltsD (D:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ltsE (E:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ltsF (F:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ltsG (G:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ltsH (H:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn