PDB entry 1ltq

View 1ltq on RCSB PDB site
Description: crystal structure of t4 polynucleotide kinase
Class: transferase
Keywords: kinase, phosphatase, alpha/beta, p-loop, transferase
Deposited on 2002-05-20, released 2002-10-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.236
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06855 (0-300)
      • modified residue (0)
      • modified residue (41)
      • modified residue (62)
      • modified residue (138)
      • modified residue (142)
      • modified residue (172)
      • modified residue (191)
      • modified residue (198)
      • modified residue (202)
      • modified residue (226)
      • modified residue (241)
      • modified residue (284)
    Domains in SCOPe 2.02: d1ltqa1, d1ltqa2
  • Heterogens: ADP, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ltqA (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltqA (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdytkkkegivtgm
    qfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelvkrn
    skrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpydlek
    cdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplvmq
    cqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf