PDB entry 1ltq

View 1ltq on RCSB PDB site
Description: crystal structure of t4 polynucleotide kinase
Deposited on 2002-05-20, released 2002-10-09
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-09, with a file datestamp of 2002-10-09.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ltqA (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltqA (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdytkkkegivtgm
    qfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelvkrn
    skrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpydlek
    cdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplvmq
    cqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf