PDB entry 1ltm

View 1ltm on RCSB PDB site
Description: accelerated x-ray structure elucidation of a 36 kda muramidase/transglycosylase using warp
Class: glycosyltransferase
Keywords: glycosyltransferase, muramidase, transglycosylase, peptidoglycan maturation, lysozyme, periplasmic
Deposited on 1997-09-26, released 1998-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 36 kda soluble lytic transglycosylase
    Species: Escherichia coli [TaxId:562]
    Gene: MLTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ltma_
  • Heterogens: NA, BCN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ltmA (A:)
    epqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqapt
    tsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigv
    etrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagam
    gygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapg
    lpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhs
    thyamavwqlgqavalarvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltmA (A:)
    epqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdngpng
    awlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgrvmgkt
    rildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfmpssyk
    qyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfktkysi
    sqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyamavwqlg
    qavalarvq