PDB entry 1ltl

View 1ltl on RCSB PDB site
Description: the dodecamer structure of mcm from archaeal m. thermoautotrophicum
Deposited on 2002-05-20, released 2003-05-27
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-27, with a file datestamp of 2003-05-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.245
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ltla_
  • Chain 'B':
    Domains in SCOP 1.65: d1ltlb_
  • Chain 'C':
    Domains in SCOP 1.65: d1ltlc_
  • Chain 'D':
    Domains in SCOP 1.65: d1ltld_
  • Chain 'E':
    Domains in SCOP 1.65: d1ltle_
  • Chain 'F':
    Domains in SCOP 1.65: d1ltlf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ltlA (A:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlA (A:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ltlB (B:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlB (B:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ltlC (C:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlC (C:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ltlD (D:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlD (D:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ltlE (E:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlE (E:)
    mktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliek
    pddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktde
    irprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklq
    eplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnyte
    fl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ltlF (F:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlF (F:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl