PDB entry 1lte

View 1lte on RCSB PDB site
Description: structure of a legume lectin with an ordered n-linked carbohydrate in complex with lactose
Class: lectin
Keywords: lectin
Deposited on 1991-06-25, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coral tree lectin
    Species: Erythrina corallodendron [TaxId:3843]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16404 (0-238)
      • conflict (23)
      • conflict (113)
      • conflict (177)
    Domains in SCOPe 2.06: d1ltea_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lteA (A:)
    vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnqskqdns
    yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe