PDB entry 1ltd

View 1ltd on RCSB PDB site
Description: the 2.6 angstroms refined structure of the escherichia coli recombinant saccharomyces cerevisiae flavocytochrome b2-sulphite complex
Class: oxidoreductase(ch-oh(d)-cytochrome(a))
Keywords: oxidoreductase(ch-oh(d)-cytochrome(a))
Deposited on 1994-01-14, released 1994-08-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.173
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavocytochrome b2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ltda1, d1ltda2
  • Chain 'B':
    Compound: flavocytochrome b2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ltdb_
  • Heterogens: SO3, FMN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ltdA (A:)
    mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
    hapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppldniinl
    ydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdistdmlg
    shvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiieaapsd
    kqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsntkagpk
    amkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvikaaeigv
    sgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclg
    akgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlka
    rtvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltdA (A:)
    kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn
    vidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppldniinlydfe
    ylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdistdmlgshvd
    vpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiieaapsdkqiq
    wyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsntalskfidps
    ltwkdieelkkktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievla
    etmpileqrnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvek
    aieilrdeiemsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefe
    da
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ltdB (B:)
    mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
    hapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppldniinl
    ydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdistdmlg
    shvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiieaapsd
    kqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsntkagpk
    amkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvikaaeigv
    sgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclg
    akgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlka
    rtvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltdB (B:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
    kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqrekdmklkfsnskfidpsltwkdieelkkktklpivikgvqrtedvikaaeig
    vsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalcl
    gakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlk
    artvgvpndvlynevyegptltefeda