PDB entry 1lt8

View 1lt8 on RCSB PDB site
Description: Reduced Homo sapiens Betaine-Homocysteine S-Methyltransferase in Complex with S-(delta-carboxybutyl)-L-Homocysteine
Class: transferase
Keywords: TRANSFERASE, homocysteine metabolism, homocysteinemia, zinc, thiol alkyl transfer
Deposited on 2002-05-20, released 2002-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine-homocysteine methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93088
      • engineered (103)
      • engineered (130)
      • engineered (185)
      • engineered (200)
      • see remark 999 (238)
      • engineered (255)
    Domains in SCOPe 2.07: d1lt8a_
  • Chain 'B':
    Compound: betaine-homocysteine methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93088
      • engineered (103)
      • engineered (130)
      • engineered (185)
      • engineered (200)
      • see remark 999 (238)
      • engineered (255)
    Domains in SCOPe 2.07: d1lt8b_
  • Heterogens: ZN, CBH, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lt8A (A:)
    mapvggkkakkgilerlnageivigdggfvfalekrgyvkagpwtpeaavehpeavrqlh
    reflragsnvmqtftfyasedklenrgnyvlekisgqevneaaadiarqvadegdalvag
    gvsqtpsylsaksetevkkvflqqlevfmkknvdfliaeyfehveeavwavetliasgkp
    vaatmaigpegdlhgvppgeaavrlvkagasiigvnchfdptislktvklmkegleaaql
    kahlmsqplayhtpdankqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggcc
    gfepyhiraiaeelapergflppasekhgswgsgldmhtkpwvrararkeywenlriasg
    rpynpsmskpdgwgvtkgtaelmqqkeatteqqlkelfekqkfksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lt8A (A:)
    kgilerlnageivigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsnv
    mqtftfyasedkgqevneaaadiarqvadegdalvaggvsqtpsylsaksetevkkvflq
    qlevfmkknvdfliaeyfehveeavwavetliasgkpvaatmaigpegdlhgvppgeaav
    rlvkagasiigvnchfdptislktvklmkegleaaqlkahlmsqplayhtpdankqgfid
    lpefpfgleprvatrwdiqkyareaynlgvryiggccgfepyhiraiaeelapergflpp
    asekhgswgsgldmhtkpwvrararkeywenlriasgrpynpsmskpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lt8B (B:)
    mapvggkkakkgilerlnageivigdggfvfalekrgyvkagpwtpeaavehpeavrqlh
    reflragsnvmqtftfyasedklenrgnyvlekisgqevneaaadiarqvadegdalvag
    gvsqtpsylsaksetevkkvflqqlevfmkknvdfliaeyfehveeavwavetliasgkp
    vaatmaigpegdlhgvppgeaavrlvkagasiigvnchfdptislktvklmkegleaaql
    kahlmsqplayhtpdankqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggcc
    gfepyhiraiaeelapergflppasekhgswgsgldmhtkpwvrararkeywenlriasg
    rpynpsmskpdgwgvtkgtaelmqqkeatteqqlkelfekqkfksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lt8B (B:)
    kgilerlnageivigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsnv
    mqtftfyaseaaadiarqvadegdalvaggvsqtpsylsaksetevkkvflqqlevfmkk
    nvdfliaeyfehveeavwavetliasgkpvaatmaigpegdlhgvppgeaavrlvkagas
    iigvnchfdptislktvklmkegleaaqlkahlmsqplayhtpdankqgfidlpefpfgl
    eprvatrwdiqkyareaynlgvryiggccgfepyhiraiaeelapergflppasekhgsw
    gsgldmhtkpwvrararkeywenlriasgrpynpsmskpd