PDB entry 1lt6

View 1lt6 on RCSB PDB site
Description: heat-labile enterotoxin b-pentamer complexed with metanitrophenylgalactoside
Class: enterotoxin
Keywords: enterotoxin
Deposited on 1997-10-01, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6d_
  • Chain 'E':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6e_
  • Chain 'F':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6f_
  • Chain 'G':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6g_
  • Chain 'H':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6h_
  • Chain 'L':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6l_
  • Chain 'M':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6m_
  • Chain 'N':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6n_
  • Chain 'O':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6o_
  • Chain 'P':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lt6p_
  • Heterogens: GAA, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6D (D:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6E (E:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6F (F:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6G (G:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6H (H:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6L (L:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6M (M:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6N (N:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6O (O:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt6P (P:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn