PDB entry 1lt4

View 1lt4 on RCSB PDB site
Description: heat-labile enterotoxin mutant s63k
Deposited on 1997-04-14, released 1997-06-16
The last revision prior to the SCOP 1.55 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1lt4a_
  • Chain 'D':
    Domains in SCOP 1.55: d1lt4d_
  • Chain 'E':
    Domains in SCOP 1.55: d1lt4e_
  • Chain 'F':
    Domains in SCOP 1.55: d1lt4f_
  • Chain 'G':
    Domains in SCOP 1.55: d1lt4g_
  • Chain 'H':
    Domains in SCOP 1.55: d1lt4h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lt4A (A:)
    rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvstk
    lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
    iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
    pqgcgnssnssrtitrtitgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lt4A (A:)
    rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvstk
    lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
    iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
    pqgcggdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt4D (D:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt4E (E:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt4F (F:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt4G (G:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lt4H (H:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn