PDB entry 1lt0

View 1lt0 on RCSB PDB site
Description: Crystal structure of the CN-bound BjFixL heme domain
Class: transferase
Keywords: PAS fold
Deposited on 2002-05-20, released 2002-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor protein fixl
    Species: Bradyrhizobium japonicum
    Gene: fixL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lt0a_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lt0A (A:)
    mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
    hdsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
    qqtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lt0A (A:)
    pdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsd
    phiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel