PDB entry 1lsy

View 1lsy on RCSB PDB site
Description: crystal structure of the mutant d52s hen egg white lysozyme with an oligosaccharide product
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1994-09-27, released 1995-01-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hen egg white lysozyme
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (Start-146)
      • conflict (69)
    Domains in SCOPe 2.03: d1lsya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lsyA (A:)
    mrsllilvlcflplaalgkvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqa
    tnrntdgstsygilqinsrwwcndgrtpgsrnlcnipcsallssditasvncakkivsdg
    ngmnawvawrnrckgtdvqawirgcrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lsyA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstsygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl